Protein coding transcript 224180

• Transcript: Ll_transcript_205267
• CDS coordinates: 2-712 (+)
• Peptide sequence: GDKTLRELSSPGKSGSFFYLTQDDKFIIKTVKLSEVKVLLRMLPNYYRHVSQYENSLVTKFYGVHCVKPIGGPKTRFIVMGNLLFSEYPIHRRFDLKGSSYGRTTAKTGEEVDETTTLKDLDLNFAFRLQRSWFKDFIKQIDHDCEFLEAEGIMDYSLLVGLHFRDDNTWDKRGLSPFLLRNGKQDSYQSEKFMRGYRFLEAELQDRDRIKSGRYVETCSGSFKSDFKHCISIDLF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_205267

• Blastp: Phosphatidylinositol 4-phosphate 5-kinase 1 from Arabidopsis with 78.97% of identity
• Blastx: Phosphatidylinositol 4-phosphate 5-kinase 1 from Arabidopsis with 78.97% of identity
• Eggnog: whole genome shotgun sequence(COG4642)
• Kegg: Link to kegg annotations (AT1G21980)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415598.1)
• Pfam: Phosphatidylinositol-4-phosphate 5-Kinase (PF01504.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;