Transcript | Ll_transcript_205268 |
---|---|
CDS coordinates | 1-699 (+) |
Peptide sequence | TISKGHKNYDLMLNLQLGIRHSVGKEASIPKEIKPSDFDPNEKFWTRFPPDGSKITPPHQSTDFRWKDYCPMVFRQLRKLFQVDPADYMLAICGDMALRELSSPGKSGSFFYLTQDDRFMIKTVKKSEVKVLLRMLPSYYQHVSRYENSLVTKFYGLHCVKPIGGQKTRFIVMGNLFCSEYPIHRRFDLKGSSYGRTTDKTEEEIDETTTLKDLDLNFAFRLQKNWFKDLIK* |
ORF Type | 5prime_partial |
Blastp | Phosphatidylinositol 4-phosphate 5-kinase 1 from Arabidopsis with 83.19% of identity |
---|---|
Blastx | Phosphatidylinositol 4-phosphate 5-kinase 1 from Arabidopsis with 82.91% of identity |
Eggnog | whole genome shotgun sequence(COG4642) |
Kegg | Link to kegg annotations (AT1G21980) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416848.1) |
Pfam | Phosphatidylinositol-4-phosphate 5-Kinase (PF01504.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer