Protein coding transcript 224204

• Transcript: Ll_transcript_203699
• CDS coordinates: 926-1345 (+)
• Peptide sequence: MILYEVLRLYPPIIGASRTVHKDMKLGNMTLPAGVQVSLPIVLVHHDCELWGHDAKEFKPERFSKGISNATSGQLSFLPFGWGPRICIGQNFAMLEAKMALSIILQHFSFELSAAYAHAPTTVLTLQPQHGAHIILHKL*
• ORF Type: complete

Annotations of Ll_transcript_203699

• Blastp: Cytochrome P450 72A14 from Arabidopsis with 69.78% of identity
• Blastx: Cytochrome P450 72A14 from Arabidopsis with 69.5% of identity
• Eggnog: Cytochrome p450(COG2124)
• Kegg: Link to kegg annotations (AT3G14680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453527.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;