Protein coding transcript 224206

• Transcript: Ll_transcript_203692
• CDS coordinates: 1288-1602 (+)
• Peptide sequence: MLPAIFKSCSDMISKWEEMLSSDGSCELDVWPFLQSLASEVISRTAFGDNHEEGRRIFELQKEQAELMMKVVLHVNIPGWRYDYYVHVNYVTNKEGSNLLRINH*
• ORF Type: complete

Annotations of Ll_transcript_203692

• Blastp: Cytochrome P450 CYP72A219 from Panax with 56.1% of identity
• Blastx: Cytochrome P450 CYP72A219 from Panax with 55.13% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453527.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;