| Transcript | Ll_transcript_203693 |
|---|---|
| CDS coordinates | 189-515 (+) |
| Peptide sequence | MGATWITSATIISVIVIASLIWVWKVLNWLWLRPKKLERMLREEGLKGNPYRILVGDISEMLKMEKEAKYKPMTLSHDIVPRVLPFVHQSVNKHGLWLRGLIQNVIFS* |
| ORF Type | complete |
| Blastp | Secologanin synthase from Catharanthus with 45.45% of identity |
|---|---|
| Blastx | Secologanin synthase from Catharanthus with 49.3% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (AAA33106) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019453527.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer