Protein coding transcript 224224

• Transcript: Ll_transcript_204171
• CDS coordinates: 215-1006 (+)
• Peptide sequence: MKRAISMECLEGRTVVQLENASLLGPSSFQRKSLSFAEVSPIDHDCEKFSQDVVRSKVLSSIKVVVLSTKINLLMPFGPMAILVDNLFDSHGLVFLFCLLGIIPLAERLGYTTEQLALFTGPAVGGLLYATFGNATELIISIHALKSGLIYLVQQSLLGSILSNLLLVLGCALFAGGVVFYKREQAFNRADTTVDFGLLLMAVMGLIFPAVLHATHTELENEKSQLNLSRFTSCIMLVAYVCYIVFQVKTQKNLQALVQEVKP*
• ORF Type: complete

Annotations of Ll_transcript_204171

• Blastp: Vacuolar cation/proton exchanger 2 from Oryza sativa with 58.85% of identity
• Blastx: Vacuolar cation/proton exchanger 2 from Oryza sativa with 58.85% of identity
• Eggnog: Calcium Proton(COG0387)
• Kegg: Link to kegg annotations (4333044)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455592.1)
• Pfam: Sodium/calcium exchanger protein (PF01699.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;