Transcript | Ll_transcript_204161 |
---|---|
CDS coordinates | 228-1019 (+) |
Peptide sequence | MKRAISMECLEGRTVVQLENASLLGPSSFQRKSLSFAEVSPIDHDCEKFSQDVVRSKVLSSIKVVVLSTKINLLMPFGPMAILVDNLFDSHGLVFLFCLLGIIPLAERLGYTTEQLALFTGPAVGGLLYATFGNATELIISIHALKSGLIYLVQQSLLGSILSNLLLVLGCALFAGGVVFYKREQAFNRADTTVDFGLLLMAVMGLIFPAVLHATHTELENEKSQLNLSRFTSCIMLVAYVCYIVFQVKTQKNLQALVQEVKP* |
ORF Type | complete |
Blastp | Vacuolar cation/proton exchanger 2 from Oryza sativa with 58.85% of identity |
---|---|
Blastx | Vacuolar cation/proton exchanger 2 from Oryza sativa with 58.85% of identity |
Eggnog | Calcium Proton(COG0387) |
Kegg | Link to kegg annotations (4333044) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019455592.1) |
Pfam | Sodium/calcium exchanger protein (PF01699.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer