Protein coding transcript 224277

• Transcript: Ll_transcript_205129
• CDS coordinates: 920-1363 (+)
• Peptide sequence: MLKWAELIDENIEEIAALDTIDGGKLYSWCKAVDIPAATNILRYYAGAADKIHGQVFKTSRNLHLYTLMEPVGVVGQIIPWNFPTIMFFTKASPALAAGCTVVLKPSEQTPLSALFYAHLAKLVWLKNLVDFGCQTQLLNYLGALAC*
• ORF Type: complete

Annotations of Ll_transcript_205129

• Blastp: Aldehyde dehydrogenase family 2 member C4 from Arabidopsis with 66.12% of identity
• Blastx: Aldehyde dehydrogenase family 2 member C4 from Arabidopsis with 49.77% of identity
• Eggnog: Dehydrogenase(COG1012)
• Kegg: Link to kegg annotations (AT3G24503)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436644.1)
• Pfam: Aldehyde dehydrogenase family (PF00171.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;