Transcript | Ll_transcript_205129 |
---|---|
CDS coordinates | 920-1363 (+) |
Peptide sequence | MLKWAELIDENIEEIAALDTIDGGKLYSWCKAVDIPAATNILRYYAGAADKIHGQVFKTSRNLHLYTLMEPVGVVGQIIPWNFPTIMFFTKASPALAAGCTVVLKPSEQTPLSALFYAHLAKLVWLKNLVDFGCQTQLLNYLGALAC* |
ORF Type | complete |
Blastp | Aldehyde dehydrogenase family 2 member C4 from Arabidopsis with 66.12% of identity |
---|---|
Blastx | Aldehyde dehydrogenase family 2 member C4 from Arabidopsis with 49.77% of identity |
Eggnog | Dehydrogenase(COG1012) |
Kegg | Link to kegg annotations (AT3G24503) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436644.1) |
Pfam | Aldehyde dehydrogenase family (PF00171.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer