Protein coding transcript 224326

• Transcript: Ll_transcript_203389
• CDS coordinates: 842-1567 (+)
• Peptide sequence: MLDAVDPKVRLSKATELVDRHLQSIRVAEKITQKVEGQLSKSQKEFLLRQQMRAIKEELGDNDDDEDDLVALERKMESAGMPQNVSKLAHRELRRLKKMQPQQPGYNSSRVYLELLADLPWQKASEEIELDLRAARERLDSDHYGLVKVKQRIIEYLAVRKLKPDARGPVLCFVGPPGVGKTSLASSIASALGRKFVRISLGGVKDEADIRGHRRTYVGSMPGRLIDGLKVNLHLNFEHLL*
• ORF Type: complete

Annotations of Ll_transcript_203389

• Blastp: Lon protease homolog 2, peroxisomal from Arabidopsis with 91.3% of identity
• Blastx: Lon protease homolog 2, peroxisomal from Spinacia with 89.1% of identity
• Eggnog: ATP-dependent serine protease that mediates the selective degradation of mutant and abnormal proteins as well as certain short-lived regulatory proteins. Required for cellular homeostasis and for survival from DNA damage and developmental changes induced by stress. Degrades polypeptides processively to yield small peptide fragments that are 5 to 10 amino acids long. Binds to DNA in a double-stranded, site-specific manner (By similarity)(COG0466)
• Kegg: Link to kegg annotations (AT5G47040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446006.1)
• Pfam: Holliday junction DNA helicase ruvB N-terminus (PF05496.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;