Transcript | Ll_transcript_203479 |
---|---|
CDS coordinates | 272-688 (+) |
Peptide sequence | MVKLTMIARVTDGLPLAEGLDDGRDVKDAEFYKQQVKALFKNLSRGHNEASRMSVETGPYVFNYIIEGRVCYLTMCDRAYPKKLAFQYLEDLRNEFERVNGSQIETAARPYAFIKFGRYQFLYYHVPFVSILSFSSGV* |
ORF Type | complete |
Blastp | 25.3 kDa vesicle transport protein from Arabidopsis with 85.71% of identity |
---|---|
Blastx | 25.3 kDa vesicle transport protein from Arabidopsis with 85.71% of identity |
Eggnog | Vesicle-associated membrane protein(COG5143) |
Kegg | Link to kegg annotations (AT1G11890) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430415.1) |
Pfam | Regulated-SNARE-like domain (PF13774.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer