Protein coding transcript 224391

• Transcript: Ll_transcript_205364
• CDS coordinates: 379-780 (+)
• Peptide sequence: MEMVPENMKRQLSLAVRSIQWIYAIFWSGSDTNPRVLIWREGYYNGDIKTRKTNQGLELNSDQIGLQRSEQLRELFRSLKTTEATKKPSATLPPEDLTDTEWLPGRTLANDRPIWLCNAHSTDCILFSRSLLAK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_205364

• Blastp: Transcription factor EGL1 from Arabidopsis with 52.26% of identity
• Blastx: Transcription factor EGL1 from Arabidopsis with 52.26% of identity
• Eggnog: Transcription factor(ENOG410Z2WK)
• Kegg: Link to kegg annotations (AT1G63650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422571.1)
• Pfam: bHLH-MYC and R2R3-MYB transcription factors N-terminal (PF14215.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;