Transcript | Ll_transcript_204626 |
---|---|
CDS coordinates | 123-824 (+) |
Peptide sequence | MAKASSGTVNPHGHSGVRIVVAGDQGTGKSSLIITAAAENFPINVPHILPPTRLPEDLYPDRVPITIIDTSSRSEDSDKVAEELQRADTVVLTYACDRPETLENLSTFWLPHLRKLEVKVPVIVVGCKLDLRDENQQVSLEQVMSPIMQQFREIETCIECSASRHIQIPEVFYYAQKAVLHPTAPLFDQESQTLKPRCVRALKRIFILCDHDRDGALSDAELNDFQVVSPPFS* |
ORF Type | complete |
Blastp | Mitochondrial Rho GTPase 1 from Arabidopsis with 73.68% of identity |
---|---|
Blastx | Mitochondrial Rho GTPase 1 from Arabidopsis with 71.31% of identity |
Eggnog | Mitochondrial GTPase involved in mitochondrial trafficking (By similarity)(ENOG410XRHW) |
Kegg | Link to kegg annotations (AT5G27540) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428456.1) |
Pfam | Ras family (PF00071.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer