Protein coding transcript 22443

• Transcript: Ll_transcript_318919
• CDS coordinates: 1029-1568 (+)
• Peptide sequence: MDRSFSRGISDEEDAETARKKLRLSKDQSAILEESFKEHNTLNPKQKLALAKKLGLRARQVEVWFQNRRARTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQELRVLKLSPHFYNHMTPPTTLTMCPSCERVAVPPSAVDFATRHHHMAPTRARPISVVGPWASGAAPIPFDVLRPRS*
• ORF Type: complete

Annotations of Ll_transcript_318919

• Blastp: Homeobox-leucine zipper protein HAT4 from Arabidopsis with 72.47% of identity
• Blastx: Homeobox-leucine zipper protein HAT4 from Arabidopsis with 66.81% of identity
• Eggnog: homeobox-leucine zipper protein(ENOG410Z2UE)
• Kegg: Link to kegg annotations (AT4G16780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421509.1)
• Pfam: Homeobox domain (PF00046.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;