Transcript | Ll_transcript_318922 |
---|---|
CDS coordinates | 3-326 (+) |
Peptide sequence | DRDSETCKGERESFLQGIDVNRLPSVVDCEDETGISSPNSTISSVSGKRSEREPNGEEIDMDRSFSRGISDEEDAETARKKLRLSKDQSAILEESFKEHNTLNPVST* |
ORF Type | 5prime_partial |
Blastp | Homeobox-leucine zipper protein HAT2 from Arabidopsis with 64.08% of identity |
---|---|
Blastx | Homeobox-leucine zipper protein HAT4 from Arabidopsis with 66.97% of identity |
Eggnog | homeobox-leucine zipper protein(ENOG410Z2UE) |
Kegg | Link to kegg annotations (AT5G47370) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421509.1) |
Pfam | HD-ZIP protein N terminus (PF04618.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer