Protein coding transcript 224467

• Transcript: Ll_transcript_204578
• CDS coordinates: 262-603 (+)
• Peptide sequence: MCESESRRVIVGNIHVLYNPNRGEVKLGQIRFLLSRAGALSEKWGSAPIVLAGDFNITPQSGIYKFLSSSELNILLYERKELSGQKSCRPAQVLGEKKETVRPFILLDGYFSF*
• ORF Type: complete

Annotations of Ll_transcript_204578

• Blastp: Carbon catabolite repressor protein 4 homolog 3 from Arabidopsis with 63.74% of identity
• Blastx: Carbon catabolite repressor protein 4 homolog 3 from Arabidopsis with 63.74% of identity
• Eggnog: Ccr4-NOT transcription complex, subunit(COG5239)
• Kegg: Link to kegg annotations (AT3G18500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424371.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;