Protein coding transcript 224471

• Transcript: Ll_transcript_204569
• CDS coordinates: 2-424 (+)
• Peptide sequence: SSSSSSLSSSSSSSSSRSCTRRWFNSVRRRNSDNSSEILRHWIEAPNQSHASPERFTVASYNILADRNAKQHSDLYLNVPSRYISWDRRKTLISNELFGWDPDILCLQEVDKYVELSDILVKAGYTGTYKVSNHCEPDEF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_204569

• Blastp: Carbon catabolite repressor protein 4 homolog 3 from Arabidopsis with 46.43% of identity
• Blastx: Carbon catabolite repressor protein 4 homolog 3 from Arabidopsis with 48.42% of identity
• Eggnog: Ccr4-NOT transcription complex, subunit(COG5239)
• Kegg: Link to kegg annotations (AT3G18500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424371.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;