Protein coding transcript 224653

• Transcript: Ll_transcript_203053
• CDS coordinates: 611-925 (+)
• Peptide sequence: MGMLKLLRLKGISEPYVTEDELKLMLRSAELSGAIEEEEQDMIENVLEIKDTHVREVMTPLVDVVAIDASLSLLDFHDLWVTHQYSRVPVFEQRVDNIMGIAYAM
• ORF Type: 3prime_partial

Annotations of Ll_transcript_203053

• Blastp: Putative DUF21 domain-containing protein At3g13070, chloroplastic from Arabidopsis with 89.52% of identity
• Blastx: Putative DUF21 domain-containing protein At3g13070, chloroplastic from Arabidopsis with 88.19% of identity
• Eggnog: CBS Domain protein(COG1253)
• Kegg: Link to kegg annotations (AT3G13070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435676.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;