Protein coding transcript 224726

• Transcript: Ll_transcript_204363
• CDS coordinates: 2-772 (+)
• Peptide sequence: LSKNDSKPFDNPTLFRSIVGALQYATITRPDLAFSVNKVCQFMSKPLEQHWVAVKRILRYLQGTMTFGIHLKAVVCPSMPIHLTALCDADWATDLDDRKSVSGACLFLGPNIIAWWSRKQQTVSRSSTEAEYRSLALASQELVWVESLLTELKIPYQVPLILCDNLSTIVMAHNLVLHNRTKHIELDLFFVRDKIQAKLLQVKHIPSEFQTADVLTKPLATAKFLVLRKQLRVADLPSIVQLPSDSGGYIRDQILN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_204363

• Blastp: Copia protein from Sophophora with 37.9% of identity
• Blastx: Uncharacterized mitochondrial protein AtMg00810 from Arabidopsis with 48.53% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429729.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;