Protein coding transcript 224779

• Transcript: Ll_transcript_205163
• CDS coordinates: 1-522 (+)
• Peptide sequence: FAKTLTQSDANNGGGFSVPRYCAETLFPRLDYSAEPPFQTIVAKDVHGQCWKFRHIYRGTPRRHLLTTGWSNFVNQKKLVAGDSIVFMRGENGDLCVGTRRAKKGGIGGGTEFSSYWNNNHATLPLFVSASGFLYGNENNKSLMRSKGSDEFVGRMVVESVTYAVNRRPFEVV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_205163

• Blastp: Auxin response factor 16 from Arabidopsis with 69.44% of identity
• Blastx: Auxin response factor 18 from Oryza sativa with 54.94% of identity
• Eggnog: auxin response factor(ENOG410ZZ2C)
• Kegg: Link to kegg annotations (AT4G30080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449806.1)
• Pfam: B3 DNA binding domain (PF02362.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;