Protein coding transcript 224798

• Transcript: Ll_transcript_205171
• CDS coordinates: 2-1018 (+)
• Peptide sequence: DNVVMEGFSRNGKGKLAPEKVAEAVELAAQGMPFEAVYYPSAGWSDFVVQAEIVDSAMMIIWSPGMRVKMAVETEDSSRTSWFQGAVSAACVPENGLWRGSPWHRIQVAWDEPELMQHAKFVSPWQVEPLSVTSTFHTAVPLAKRFRAAQDSVGLTDGKGDPFFPMTGYTNSTMGQLNQTLSSYSTFPAGMQGARHNLFSTTAFVKFSSDMNHLCLGNSFGNNTAPSSKILSTELNIGSSQSDNLSPDSQCSLHSFGTECVRTHNCNSTKPVSRSIQLFGTTIETKQPVKSGFHLTGCIGNDSCKCHDEIEGLTLELSLAYSKMLNSLDGLDDGRHYL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_205171

• Blastp: Auxin response factor 17 from Arabidopsis with 42.41% of identity
• Blastx: Auxin response factor 17 from Arabidopsis with 42.41% of identity
• Eggnog: auxin response factor(ENOG410ZJKK)
• Kegg: Link to kegg annotations (AT1G77850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414370.1)
• Pfam: Auxin response factor (PF06507.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;