Protein coding transcript 224815

• Transcript: Ll_transcript_205292
• CDS coordinates: 130-885 (+)
• Peptide sequence: MDHQGHGQNPNMGVVGSGTQLPYGSNPYQQSQMTGAPGPVVTSSGNMQSALAYQHIHQQQQQQLQQQLQQFWANQYQEIEKVTDFKNHSLPLARIKKIMKADEDVRMISAEAPVIFARACEMFILELTLRSWNHTEENKRRTLQKNDIAAAITRTDIFDFLVDIVPREDLKDEILASMPRGTMPGAGGPADGLPYCYMPPQHAPQVGAPGVIMGEPVMDPNMYAQQSHNTYMAPQMWPQPPEQQQSSPPDH*
• ORF Type: complete

Annotations of Ll_transcript_205292

• Blastp: Nuclear transcription factor Y subunit C-9 from Arabidopsis with 63.03% of identity
• Blastx: Nuclear transcription factor Y subunit C-9 from Arabidopsis with 65.07% of identity
• Eggnog: Nuclear transcription factor Y(COG5208)
• Kegg: Link to kegg annotations (AT1G08970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419871.1)
• Pfam: Core histone H2A/H2B/H3/H4 (PF00125.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;