Protein coding transcript 224846

• Transcript: Ll_transcript_204508
• CDS coordinates: 366-746 (+)
• Peptide sequence: MIKLFKVKEKQRELAENAGGGPPIKKQSAGELRVHKDISELNLPKSCAIQFPNGKDDLMNFEVTIRPDDGYYLGGTFLFSFQVSLIYPHEAPKVKCKTKEPNYEDPLNHDVAAVLRDNPKLFESNVR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_204508

• Blastp: NEDD8-conjugating enzyme Ubc12 from Arabidopsis with 62.87% of identity
• Blastx: NEDD8-conjugating enzyme Ubc12 from Arabidopsis with 62.87% of identity
• Eggnog: ubiquitin-conjugating enzyme(ENOG410XS81)
• Kegg: Link to kegg annotations (AT4G36800)
• CantataDB: Link to cantataDB annotations (CNT0002643)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020217160.1)
• Pfam: Ubiquitin-conjugating enzyme (PF00179.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;