Protein coding transcript 224872

• Transcript: Ll_transcript_204826
• CDS coordinates: 695-1036 (+)
• Peptide sequence: MFRISNVGLSTSINFRIQGHTLKLVEVEGSHTVQNIYNSLDVHVGQSVSVLVTLNNSPEDYYIVASTRFSKKILTATAVLHYTNSHSPASGPLPSPPTYQYHWSVRQARSFRL*
• ORF Type: complete

Annotations of Ll_transcript_204826

• Blastp: L-ascorbate oxidase homolog from Nicotiana with 55.26% of identity
• Blastx: L-ascorbate oxidase homolog from Nicotiana with 53.6% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107766889)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446721.1)
• Pfam: Multicopper oxidase (PF00394.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;