Protein coding transcript 224880

• Transcript: Ll_transcript_204796
• CDS coordinates: 212-856 (+)
• Peptide sequence: MRNSIMLQLLLCFVIGLVSVCVVQGEDAYKFYTWTVTYGTISPLGTPQQVILINGQFPGPRLDLVTNDNVVLNLFNKLDEPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQPKDQIGTYSYFPSTAFHKAAGGFGGLNVYHRSVIPIPYSNPDGDFTLLIGDWYKTNHKTLRQTLDSGKSLAFPDGLLINGQTHTTFTANQGMPVLL*
• ORF Type: complete

Annotations of Ll_transcript_204796

• Blastp: L-ascorbate oxidase homolog from Nicotiana with 55.45% of identity
• Blastx: L-ascorbate oxidase homolog from Nicotiana with 55.45% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107766889)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421361.1)
• Pfam: Multicopper oxidase (PF07732.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;