Transcript | Ll_transcript_352591 |
---|---|
CDS coordinates | 1-327 (+) |
Peptide sequence | PTPQKLAKTPIQKTIRKTFKGAANLSNLLPTGTVLIFNILSPAFTHQGKCHTITSKTMTIALLTFCSLYCFIISFTDSFRDERGKVRHGIASLNGLWVMDSSVKLPSDE |
ORF Type | internal |
Blastp | Protein DMP7 from Arabidopsis with 52.38% of identity |
---|---|
Blastx | Protein DMP7 from Arabidopsis with 52.38% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AT4G28485) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452071.1) |
Pfam | Protein of unknown function (DUF679) (PF05078.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer