| Transcript | Ll_transcript_352591 |
|---|---|
| CDS coordinates | 1-327 (+) |
| Peptide sequence | PTPQKLAKTPIQKTIRKTFKGAANLSNLLPTGTVLIFNILSPAFTHQGKCHTITSKTMTIALLTFCSLYCFIISFTDSFRDERGKVRHGIASLNGLWVMDSSVKLPSDE |
| ORF Type | internal |
| Blastp | Protein DMP7 from Arabidopsis with 52.38% of identity |
|---|---|
| Blastx | Protein DMP7 from Arabidopsis with 52.38% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (AT4G28485) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019452071.1) |
| Pfam | Protein of unknown function (DUF679) (PF05078.11) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer