Transcript | Ll_transcript_322984 |
---|---|
CDS coordinates | 567-1790 (+) |
Peptide sequence | MTKGAKFAQNHATTHCKYLVWTPSNGLGNRMLTLVAAFLYAILTDRVLLVKFGDDMLGLFCEPFPRSSWLLPMDFPYWKDRKHIQTYQNMLIKHRGNNSKELLPSFLILNLQHTHDGRNNFFHCDHSQELLHKVPVLILSSDQYFVPSLFMIPSFREDLSKMFPEKDTVFHHMGRYLFHPSNEAWELITKFHQAHFAKANERIGVQIRVFNTHKAPHQTIINEIIACTVKHKLLPELDLQKPAEAASVLKNQTTKAVLVASLFSEYGEKLRALYLRNTTVTNEVIRVYQPSHEERQKSSNGMHNIKAWTEIYLLSLCDSLITSRKSTFGYVAQSLGGLKPLILQRAFGETIPNPPCQRARSMEPCFHYPPKYDCSRSNTPVDFTSLFHYMMHCEDVSSGLRMVNVKH* |
ORF Type | complete |
Blastp | Galactoside 2-alpha-L-fucosyltransferase from Pisum with 49% of identity |
---|---|
Blastx | Galactoside 2-alpha-L-fucosyltransferase from Pisum with 48.67% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0000831) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447633.1) |
Pfam | Xyloglucan fucosyltransferase (PF03254.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer