Protein coding transcript 225069

• Transcript: Ll_transcript_172119
• CDS coordinates: 838-1146 (+)
• Peptide sequence: MVSSIQYRKLDFEEFCAAAISVHQLEGMVSWEQHARSAYELFEKDGNRPIMVEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTLQKA*
• ORF Type: complete

Annotations of Ll_transcript_172119

• Blastp: CDPK-related kinase 1 from Arabidopsis with 87.25% of identity
• Blastx: CDPK-related kinase 1 from Arabidopsis with 84.43% of identity
• Eggnog: calcium-dependent protein kinase(ENOG410XRMJ)
• Kegg: Link to kegg annotations (AT2G41140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020211606.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;