Protein coding transcript 225167

• Transcript: Ll_transcript_173203
• CDS coordinates: 336-1487 (+)
• Peptide sequence: MDEFLEGAYERFVVKKEGTAKQRKRVKKSYDAGKELLEGGEDDVQPKYDSDEDLAVQEANPLVVPLNDGTGPTQEEITNRWFSQDVFAEAAEEGDFEKQESEDEMDIDGHKDKKSTTTAVKEKKSILKKAKENKTEAPAAVVIDKPQSQASKADDDFEIVPAPGTDSSDDSSSESEDDDIETKAEVLACARKMLRKKQRELMLDDAYNKYMFDDEGLPKWFLDEEKRHRIPVKPVTKEEIAAMKAQFKEIDARPAKKVAEAKARKKRVAMRKLEKVRKKATAISDQTEISDRSKSKQIEKLYKKATAPQRTKKEYVVAKKGVQVKTGKGKVLVDRRMKKDARTRGMGKSGKGGPKSKGKGGKGSKGKTASKGSAKKGGRKGNK*
• ORF Type: complete

Annotations of Ll_transcript_173203

• Blastp: pre-rRNA processing protein FTSJ3 from Pongo with 34.83% of identity
• Blastx: Putative rRNA methyltransferase from Dictyostelium with 44.72% of identity
• Eggnog: Specifically methylates the uridine in position 2552 of 23S rRNA at the 2'-O position of the ribose in the fully assembled 50S ribosomal subunit (By similarity)(COG0293)
• Kegg: Link to kegg annotations (100172587)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413490.1)
• Pfam: Spb1 C-terminal domain (PF07780.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;