Protein coding transcript 225178

• Transcript: Ll_transcript_171308
• CDS coordinates: 947-1471 (+)
• Peptide sequence: MITLQACNPEEDGLFSFDVHSDGDGLRHLNATLKESEAANAFDPNASLLDFPPRRSAYSCIQMNGKHVLRFAVRNVPQSIESALSKAGLSVSSIDWLLLHQANERIIDSVANRLEVGREKVIRNIENYGNTSAASIPLALDEGVRSGKIKEGQTIASAGFGAGLTWASAIFRWC*
• ORF Type: complete

Annotations of Ll_transcript_171308

• Blastp: 3-oxoacyl-[acyl-carrier-protein] synthase 3 A, chloroplastic from Cuphea with 70.93% of identity
• Blastx: 3-oxoacyl-[acyl-carrier-protein] synthase 3 B, chloroplastic from Cuphea with 69% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443316.1)
• Pfam: Chalcone and stilbene synthases, C-terminal domain (PF02797.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;