Protein coding transcript 225181

• Transcript: Ll_transcript_171278
• CDS coordinates: 177-1328 (+)
• Peptide sequence: MANASGFFSLRIQPSMPIHQFLCLASTQGAHITTSPSQSRLPRLVSQGCKLVGCGSAVPSLEISNDDLSKFVETSDEWISSRTGIRRRRVLSGKDNLTNLAAEAARKALEMANVDPDDLDLILMCTSTPEDLFGSAPQIQKQLGCKTNPLAYDITAACSGFVLGLISAASHIRGSGFQNVLVVGADALSRYVDWTDRGSCILFGDAAGAVVVQACNSEEDGLFGFDVHSDGNGQRHLNAAIKENNSNNTLDSSNGSVLGFPPRQSSYSCIQMNGKEVFRFAVRSVPQSIVSALEKAGLPASSIDWLLLHQANQRIIEAVATRLEVPPERVISNLANYGNTSAASIPLALDEAVRSGKVKEGQTIAVSGFGAGLSWGSAIIRWG*
• ORF Type: complete

Annotations of Ll_transcript_171278

• Blastp: 3-oxoacyl-[acyl-carrier-protein] synthase III, chloroplastic from Arabidopsis with 72.48% of identity
• Blastx: 3-oxoacyl-[acyl-carrier-protein] synthase III, chloroplastic from Arabidopsis with 72.48% of identity
• Eggnog: Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched- chain and or straight-chain of fatty acids (By similarity)(COG0332)
• Kegg: Link to kegg annotations (AT1G62640)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447643.1)
• Pfam: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III (PF08545.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;