Protein coding transcript 225182

• Transcript: Ll_transcript_171284
• CDS coordinates: 177-653 (+)
• Peptide sequence: MANASGFFSLRIQPSMPIHQFLCLASTQGAHITTSPSQSRLPRLVSQGCKLVGCGSAVPSLEISNDDLSKFVETSDEWISSRTGIRRRRVLSGKDNLTNLAAEAARKALEMAKVDPDDLDLILMCTSTPEDLFGSAPQVWVQGVTLRNILLFYLTLAK*
• ORF Type: complete

Annotations of Ll_transcript_171284

• Blastp: 3-oxoacyl-[acyl-carrier-protein] synthase 3 A, chloroplastic from Cuphea with 54.55% of identity
• Blastx: 3-oxoacyl-[acyl-carrier-protein] synthase 3 B, chloroplastic from Cuphea with 83.24% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436161.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;