Protein coding transcript 225185

• Transcript: Ll_transcript_171296
• CDS coordinates: 950-1834 (+)
• Peptide sequence: MLAGKDNLTNLAAEAARKALEMANVDPDDLDLILMCTSTPEDLFGSAPQIQKQLGCKTNPLAYDITAACSGFVLGLISAASHIRGSGFQNVLVVGADALSRYVDWTDRGSCILFGDAAGAVVVQACNSEEDGLFGFDVHSDGNGQRHLNAAIKENNSNNTLDSSNGSVLGFPPRQSSYSCIQMNGKEVFRFAVRSVPQSIVSALEKAGLPASSIDWLLLHQANQRIIEAVATRLEVPPERVISNLANYGNTSAASIPLALDEAVRSGKVKEGQTIAVSGFGAGLSWGSAIIRWG*
• ORF Type: complete

Annotations of Ll_transcript_171296

• Blastp: 3-oxoacyl-[acyl-carrier-protein] synthase 3 A, chloroplastic from Cuphea with 80.61% of identity
• Blastx: 3-oxoacyl-[acyl-carrier-protein] synthase 3 A, chloroplastic from Cuphea with 80.61% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447643.1)
• Pfam: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III (PF08545.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;