Protein coding transcript 225223

• Transcript: Ll_transcript_171829
• CDS coordinates: 776-1417 (+)
• Peptide sequence: MGSKVTVWKEDKGENGQADSEDGSMKWMPSKMRIMRKMMASDQTRGSYVAGSSMQKFEQQKQPLSPLGTDNSSNNYPNHSTSNTVRVCSDCHTTKTPLWRSGPRGPKSLCNACGIRQRKARRAMAAANGTIVMAAEKSVKGKEKKYKTECAPPKMKKKRKLQSKASSQSTKKFSFEDLTLRLSKNVAFKQVFPQDEKEAAILLMALSYGLVHG*
• ORF Type: complete

Annotations of Ll_transcript_171829

• Blastp: Putative GATA transcription factor 22 from Arabidopsis with 38.25% of identity
• Blastx: Putative GATA transcription factor 22 from Arabidopsis with 38.25% of identity
• Eggnog: Transcription factor(COG5641)
• Kegg: Link to kegg annotations (AT4G26150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433018.1)
• Pfam: GATA zinc finger (PF00320.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;