Protein coding transcript 225227

• Transcript: Ll_transcript_171833
• CDS coordinates: 1-312 (+)
• Peptide sequence: DMSGAGNGVSSALALSNAITNLAASVFGEISKLEPMTSERKARWRKEIEWLLSVTDHIVEFAPSQQIGKDGTSMEIMTTRQQSDLLMNIHAMHKLATMLIVSS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_171833

• Blastp: Rop guanine nucleotide exchange factor 12 from Arabidopsis with 77% of identity
• Blastx: Rop guanine nucleotide exchange factor 9 from Arabidopsis with 74% of identity
• Eggnog: guanine nucleotide exchange factor(ENOG410YG86)
• Kegg: Link to kegg annotations (AT1G79860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436436.1)
• Pfam: PRONE (Plant-specific Rop nucleotide exchanger) (PF03759.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;