Transcript | Ll_transcript_171822 |
---|---|
CDS coordinates | 1-357 (+) |
Peptide sequence | DMSGAGNGVSSALALSNAITNLAASVFGEISKLEPMTSERKARWRKEIEWLLSVTDHIVEFAPSQQIGKDGTSMEIMTTRQRSDLLMNIPAMRKLDAMLIDTLDNFRDQNAFWCVSKND |
ORF Type | internal |
Blastp | Rop guanine nucleotide exchange factor 9 from Arabidopsis with 77.12% of identity |
---|---|
Blastx | Rop guanine nucleotide exchange factor 9 from Arabidopsis with 77.12% of identity |
Eggnog | guanine nucleotide exchange factor(ENOG410YG86) |
Kegg | Link to kegg annotations (AT4G13240) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448385.1) |
Pfam | PRONE (Plant-specific Rop nucleotide exchanger) (PF03759.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer