Protein coding transcript 225228

• Transcript: Ll_transcript_171822
• CDS coordinates: 1-357 (+)
• Peptide sequence: DMSGAGNGVSSALALSNAITNLAASVFGEISKLEPMTSERKARWRKEIEWLLSVTDHIVEFAPSQQIGKDGTSMEIMTTRQRSDLLMNIPAMRKLDAMLIDTLDNFRDQNAFWCVSKND
• ORF Type: internal

Annotations of Ll_transcript_171822

• Blastp: Rop guanine nucleotide exchange factor 9 from Arabidopsis with 77.12% of identity
• Blastx: Rop guanine nucleotide exchange factor 9 from Arabidopsis with 77.12% of identity
• Eggnog: guanine nucleotide exchange factor(ENOG410YG86)
• Kegg: Link to kegg annotations (AT4G13240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448385.1)
• Pfam: PRONE (Plant-specific Rop nucleotide exchanger) (PF03759.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;