Protein coding transcript 225229

• Transcript: Ll_transcript_171823
• CDS coordinates: 137-451 (+)
• Peptide sequence: MMLIVLPCTQLQSWHPLVMQHLFFGEISKLEPMTSERKARWRKEIEWLLSTGLANVSLKYNSVGFYQMAKIAVTPSIVMAEFVLYSKKVSWPKGSASSSSGGFLV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_171823

• Blastp: Nucleotide-sugar uncharacterized transporter 1 from Arabidopsis with 84.44% of identity
• Blastx: Nucleotide-sugar uncharacterized transporter 1 from Arabidopsis with 84.44% of identity
• Eggnog: solute carrier family 35 member(ENOG410XP1S)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014625490.1)
• Pfam: PRONE (Plant-specific Rop nucleotide exchanger) (PF03759.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;