Protein coding transcript 225232

• Transcript: Ll_transcript_171828
• CDS coordinates: 442-1227 (+)
• Peptide sequence: MFNFLLTNDVKKILKRKDSDAGETGRALEDFRASLFNEFRSSEGVKRQQRTSGPAAALFFNFLVAVGIIFMNKMVLQTVQFKFPILLSLIHYAVSWLLMALLKVFSLLPASPSSKSTQMSALFSLGIVMSLSTGLANVSLKYNSVGFYQMAKIAVTPSIVMAEFVLYRKKVSWPKAVALTVVSIGVAVATVTDLQFQLFGACVALAWIVPSAVNKILWSRLQQQENWAALALMWKITPITVIFLAAMIPWLDPPGVLSFDWN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_171828

• Blastp: Nucleotide-sugar uncharacterized transporter 1 from Arabidopsis with 72.18% of identity
• Blastx: Nucleotide-sugar uncharacterized transporter 1 from Arabidopsis with 72.28% of identity
• Eggnog: solute carrier family 35 member(ENOG410XP1S)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462608.1)
• Pfam: Triose-phosphate Transporter family (PF03151.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;