Protein coding transcript 225236

• Transcript: Ll_transcript_171897
• CDS coordinates: 231-890 (+)
• Peptide sequence: MEEVVLFVDDLRLLSGVSRCRICHEEEFESVKSLEAPCACSGTVKFAHRDCIQKWCDEKGNTVCEICLQKYEPGYTTVPKKCQISDATMTIRGSLQISRMEQEPLNARIEGIVEGIAIEDHYSECTSAADRSASCCRSMALTFTLILLVRHLFEVLSNGMEDYPFTILTVFILRASGIIVPMYIIIRTLGVIHKSIQRHYLQVYFHFHVLFNHSLVGHD*
• ORF Type: complete

Annotations of Ll_transcript_171897

• Blastp: E3 ubiquitin-protein ligase MARCH7 from Homo with 37.7% of identity
• Blastx: Probable E3 ubiquitin ligase SUD1 from Arabidopsis with 41.67% of identity
• Eggnog: (Membrane-Associated Ring finger (C3HC4))(COG5183)
• Kegg: Link to kegg annotations (64844)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426993.1)
• Pfam: RING-variant domain (PF12906.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;