Transcript | Ll_transcript_171729 |
---|---|
CDS coordinates | 3-668 (+) |
Peptide sequence | QRIGKDKFPSSNPTQLPLSPFIPKSKTQHRKTLDIGKKKVLKTEKTEIMDSDQGKLFIGGISWDTNEDKLKDYFGNYGVVSHASVMRDKNTGKPRGFAFVVFSDPSVVDRVLEDTHVIDGRTVDAKRAFSREDQQISVNSRTGNSNSGRSSGNGGNTRTKKIFVGGLPPTLTEEKFREYFEAYGQVTDVVVMYDQNTGRPRGFGFISFDTEDAVDRVLHKTF |
ORF Type | internal |
Blastp | Heterogeneous nuclear ribonucleoprotein 1 from Arabidopsis with 71.84% of identity |
---|---|
Blastx | Heterogeneous nuclear ribonucleoprotein 1 from Arabidopsis with 71.84% of identity |
Eggnog | Rna-binding protein(ENOG410YA8Z) |
Kegg | Link to kegg annotations (AT4G14300) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449967.1) |
Pfam | RNA recognition motif (PF16367.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer