Protein coding transcript 225372

• Transcript: Ll_transcript_171138
• CDS coordinates: 1670-2167 (+)
• Peptide sequence: MRVAFVDILQTRGFQGLYAGLSPTLLEIIPYAGLQFGTYDTFKRWAMAWNHFRYSNTIADDSLSSFQLFICGLAAGTCAKLVCHPLDVVKKRFQIEGLQRHPRYGARVEHRAYRNMFDAMQRILQFEGLAGLYKGILPSTVKAAPAGAVTFVAYELTSDWLETLF*
• ORF Type: complete

Annotations of Ll_transcript_171138

• Blastp: Mitochondrial thiamine diphosphate carrier 2 from Arabidopsis with 75.45% of identity
• Blastx: Mitochondrial thiamine diphosphate carrier 2 from Arabidopsis with 75.44% of identity
• Eggnog: Solute carrier family 25(ENOG410ZRF1)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450973.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;