| Transcript | Ll_transcript_171154 |
|---|---|
| CDS coordinates | 221-535 (+) |
| Peptide sequence | MEGESSQLKRALIDSSAGAISGGISRTLTSPLDVIKIRFQVQLEPTSTWALLRRDLVMPSKYTGMFQASRDIFREEGMPGFWRGNVPALLMVMPYTAIQFAVLH* |
| ORF Type | complete |
| Blastp | Mitochondrial thiamine diphosphate carrier 2 from Zea with 79.21% of identity |
|---|---|
| Blastx | Mitochondrial thiamine diphosphate carrier 2 from Zea with 80.19% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (103650800) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019450973.1) |
| Pfam | Mitochondrial carrier protein (PF00153.26) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer