Protein coding transcript 225384

• Transcript: Ll_transcript_171120
• CDS coordinates: 3-353 (+)
• Peptide sequence: LNSSLWLSVFVAMEGESSQLKRALIDSSAGAISGGISRTLTSPLDVIKIRFQVQLEPTSTWALLRRDLVMPSKYTGMFQASRDIFREEGMPGFWRGNVPALLMVMPYTAIQFAVLH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_171120

• Blastp: Mitochondrial thiamine diphosphate carrier 2 from Zea with 79.21% of identity
• Blastx: Mitochondrial thiamine diphosphate carrier 2 from Zea with 76.65% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (103650800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450973.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;