Protein coding transcript 225421

• Transcript: Ll_transcript_170565
• CDS coordinates: 720-2108 (+)
• Peptide sequence: MKLHFSSVALVLLSFILSLLDLIVADLNSDTQALLEFASNVPHGTRLNWSDSSSICTSWIGVTCNSNRTRVIGLHLPGIGLTGSIPENSIGKLDALRILSLHSNGLRGNIPSNILSIHSLQVAHLQRNNFSGLIPSSVSPKLIALDISFNSFSGTIPSALQNLRRLTWFYLQNNSISGSIPDFNLPRLKYLNLSYNNLNGSIPISIETFPYTSFVGNSLLCGPPLNHCSLLSPSPAYQPLSPSNTQNQEPTTHRKKFGLAPILALVIGGIAFISLLVLVIIVCCFKGENRKSSGILKGKASSCAGTTEVSKSFGSGVQEAEKNKLFFFEGCSYSFDLEDLLKASAEVLGKGSYGTAYKAVLEEGTTVVVKRLKEVMVGKKEFEQQMEIVGRIGCHSNVMLLRAYFYSKDEKLLVYNYMLGGSLFFLLHGMFYLDQWFKNLLSWLICAKFCSKVAFHACYISL*
• ORF Type: complete

Annotations of Ll_transcript_170565

• Blastp: Probable inactive receptor kinase At3g08680 from Arabidopsis with 51.83% of identity
• Blastx: Probable inactive receptor kinase At3g08680 from Arabidopsis with 53.51% of identity
• Eggnog: Leucine rich repeat N-terminal domain(ENOG411040X)
• Kegg: Link to kegg annotations (AT3G08680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430937.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;