Transcript | Ll_transcript_173238 |
---|---|
CDS coordinates | 597-1280 (+) |
Peptide sequence | MEKEIAPIMTEYWEKAEFPFQIIPKIGSLNIAGGTIKGYGCPGLSVTGGALAAAEIARVDASCSTFFVVHSSLAMLTIALCGSEAQKQKYLPSLAKLQTIACWALTEPDYGSDASALNTTATKVEGGWILDGQKRWIGNSTFADLLVIFARNTTTNQINGYIVKKDVPGLTVTKIENKIGLRIVQNGDIILRKVFVPDEDRIAELNSFQDTNRVRLCMHFLLLLLLQ* |
ORF Type | complete |
Blastp | Acyl-coenzyme A oxidase 4, peroxisomal from Arabidopsis with 79.91% of identity |
---|---|
Blastx | Acyl-coenzyme A oxidase 4, peroxisomal from Arabidopsis with 76.33% of identity |
Eggnog | acyl-CoA dehydrogenase(COG1960) |
Kegg | Link to kegg annotations (AT3G51840) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450332.1) |
Pfam | Acyl-CoA dehydrogenase, N-terminal domain (PF02771.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer