Protein coding transcript 225463

• Transcript: Ll_transcript_173230
• CDS coordinates: 597-1280 (+)
• Peptide sequence: MEKEIAPIMTEYWEKAEFPFQIIPKIGSLNIAGGTIKGYGCPGLSVTGGALAAAEIARVDASCSTFFVVHSSLAMLTIALCGSEAQKQKYLPSLAKLQTIACWALTEPDYGSDASALNTTATKVEGGWILDGQKRWIGNSTFADLLVIFARNTTTNQINGYIVKKDVPGLTVTKIENKIGLRIVQNGDIILRKVFVPDEDRIAELNSFQDTNRVRLCMHFLLLLLLQ*
• ORF Type: complete

Annotations of Ll_transcript_173230

• Blastp: Acyl-coenzyme A oxidase 4, peroxisomal from Arabidopsis with 79.91% of identity
• Blastx: Acyl-coenzyme A oxidase 4, peroxisomal from Arabidopsis with 76.33% of identity
• Eggnog: acyl-CoA dehydrogenase(COG1960)
• Kegg: Link to kegg annotations (AT3G51840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450332.1)
• Pfam: Acyl-CoA dehydrogenase, N-terminal domain (PF02771.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;