Protein coding transcript 225537

• Transcript: Ll_transcript_172419
• CDS coordinates: 256-969 (+)
• Peptide sequence: MMIQRTVCFSSLRKLLHQAGCVSSSSKVGAYNGYASQSSSSLPLPFPSYSGEEYADVDWDSLGFGLVPTDYMYINKCSAGHNFGDGQLNRYGHIELSPSAGVLNYGQGLFEGTKAYRKEDGKLLLFRPEQNAIRMQNGAERMCMISPSIEQFVHALKQTVLANKRWVPPPGKGSLYLRPLLLGTGPVLGLAPAPEYTFLIYASPVRNYFKVSAPLFIHICSFILHTYYSNSHSFNKI*
• ORF Type: complete

Annotations of Ll_transcript_172419

• Blastp: Branched-chain amino acid aminotransferase 2, chloroplastic from Humulus with 75.32% of identity
• Blastx: Branched-chain amino acid aminotransferase 2, chloroplastic from Humulus with 75.32% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437870.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;