Protein coding transcript 225539

• Transcript: Ll_transcript_172414
• CDS coordinates: 256-648 (+)
• Peptide sequence: MMIQRTVCFSSLRKLLHQAGCVSSSSKVGAYNGYASQSSSSLPLPFPSYSGEEYADVDWDSLGFGLVPTDYMYINKCSAGHNFGDGQLNRYGHIELSPSAGVLNYGQVYVFIDMYVSVVMIGQTTPLSIG*
• ORF Type: complete

Annotations of Ll_transcript_172414

• Blastp: Branched-chain amino acid aminotransferase 2, chloroplastic from Humulus with 69.09% of identity
• Blastx: Branched-chain-amino-acid aminotransferase 5, chloroplastic from Arabidopsis with 81.73% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016163874.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;