Protein coding transcript 225540

• Transcript: Ll_transcript_172415
• CDS coordinates: 256-1425 (+)
• Peptide sequence: MMIQRTVCFSSLRKLLHQAGCVSSSSKVGAYNGYASQSSSSLPLPFPSYSGEEYADVDWDSLGFGLVPTDYMYINKCSAGHNFGDGQLNRYGHIELSPSAGVLNYGQGLFEGTKAYRKEDGKLLLFRPEQNAIRMQNGAERMCMISPSIEQFVHALKQTVLANKRWVPPPGKGSLYLRPLLLGTGPVLGLAPAPEYTFLIYASPVRNYFKEGSAPLNLYVEEDYDRASRRGTGSVKTISNYAPVLMAQIRAKSRGFSDVLYLDSATKKNLEEVSSCNIFIAKGKCIKTPATNGTILAGITRKSVLEIARDHNYQVEERAVTVDELIEADEVFCTGTAVGVAPVGSVTYQDRRVEYITGSGTICQELNATLLGIQTGIIEDKNGWVIEIN*
• ORF Type: complete

Annotations of Ll_transcript_172415

• Blastp: Branched-chain-amino-acid aminotransferase 2, chloroplastic from Arabidopsis with 67.78% of identity
• Blastx: Branched-chain-amino-acid aminotransferase 2, chloroplastic from Arabidopsis with 71.13% of identity
• Eggnog: brancheD-chain amino acid aminotransferase(COG0115)
• Kegg: Link to kegg annotations (AT1G10070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437870.1)
• Pfam: Amino-transferase class IV (PF01063.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;