Transcript | Ll_transcript_172420 |
---|---|
CDS coordinates | 973-1476 (+) |
Peptide sequence | MVGGSEEAFLAAKSVFFSMGKSAIYCGGAGSGSAAKICNNLAMAVSMLGVSEALALGQSLGVSATTLTKIFNCSSARCWSSDAYNPVPGVMEGVPSSRDYNGGFSSKLMVKDLNLAVESAKHAECKYPLTSQAQKIYSELCSGGHEGRDFSCAFRHYYSGMDQNQDH* |
ORF Type | complete |
Blastp | Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial from Arabidopsis with 71.17% of identity |
---|---|
Blastx | Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial from Arabidopsis with 68.33% of identity |
Eggnog | Dehydrogenase(COG2084) |
Kegg | Link to kegg annotations (AT4G20930) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425632.1) |
Pfam | NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase (PF14833.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer