Transcript | Ll_transcript_320671 |
---|---|
CDS coordinates | 2-688 (+) |
Peptide sequence | DWMMHEFRLPCISDSSRPTKSFSEKSITASDSWAICRIFKKTTSMSMAQKALSQSWFSQFPGTMDILTLDDANCNLNNQFNNSDNNISSCPTTKIASSTIQQFQHQQQELHQLSPSDIPSYKPIISNNITNPNTDDDSFMFCTLETIGSTYPIDCIGFEDTNNQHYSKSSGFSINLPQDMQMQGNMPSPMQLNGFPFNLPPNDDDPIFPWESHPCPNDMSTNKCYMIN* |
ORF Type | 5prime_partial |
Blastp | Protein FEZ from Arabidopsis with 38.89% of identity |
---|---|
Blastx | Putative NAC domain-containing protein 94 from Arabidopsis with 44.12% of identity |
Eggnog | NAC domain-containing protein(ENOG410YHVU) |
Kegg | Link to kegg annotations (AT1G26870) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432428.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer